Cerrado

Neuro fuzzy systems

Este proyecto recibió 12 ofertas de freelancers talentosos con una oferta promedio de $280 USD.

Obtén cotizaciones gratis para un proyecto como este
Empleador trabajando
Presupuesto de Proyecto
$30 - $250 USD
Ofertas Totales
12
Descripción del Proyecto

I need someone to design a neurofuzzy system for protein secondary structure prediction. Given a protein sequence it should output the secondary sequence of that protein sequence

For example if the protein sequence is KSFPEVVGKTVDQAREYFTLHYPQYNVYFLPEGSPVTLDLRYNRVRVFYNPGTNVVNHVPHVG the secondary structure should be CCCHHHCCCCHHHHHHHHHHHCCCCEEEEEECCCCEECCCCCCEEEEEEECCCCEECCCCEEC.

Buscando hacer algo de dinero?

  • Establece tu presupuesto y período de tiempo
  • Describe tu propuesta
  • Consigue pago por tu trabajo

Contrata Freelancers que también oferten en este proyecto

    • Forbes
    • The New York Times
    • Time
    • Wall Street Journal
    • Times Online